Rabbit anti-Human EPB41 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04032P

• Product Name:
• Rabbit anti-Human EPB41 Polyclonal Antibody

• Synonym:
• HE; EL1; 4.1R

• Description:
• The antibody against EPB41 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human EPB41(NP_001159477.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 700-800 of human EPB41(NP_001159477.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• EPB41

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• RPSEWDKRLSTHSPFRTLNINGQIPTGEGPPLVKTQTVTISDNANAVKSEIPTKDVPIVHTETKTITYEAAQTDDNSGDLDPGVLLTAQTITSETPSSTTT

• Gene ID:
• 2035

• Uniprot-ID:
• P11171

• Purification Method:
• Affinity purification

• Positive Samples:
• K-562, , HEL