Rabbit anti-Human EIF4G2/p97 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04244P

• Product Name:
• Rabbit anti-Human EIF4G2/p97 Polyclonal Antibody

• Synonym:
• P97; AAG1; DAP5; NAT1; EIF4G2/p97

• Description:
• The antibody against EIF4G2/p97 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 320-490 of human EIF4G2/p97 (NP_001409.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 320-490 of human EIF4G2/p97 (NP_001409.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• EIF4G2/p97

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PKTINQIRQDAVKDLGVFIPAPMAQGMRSDFFLEGPFMPPRMKMDRDPLGGLADMFGQMPGSGIGTGPGVIQDRFSPTMGRHRSNQLFNGHGGHIMPPTQSQFGEMGGKFMKSQGLSQLYHNQSQGLLSQLQGQSKDMPPRFSKKGQLNADEISLRPAQSFLMNKNQVPKL

• Gene ID:
• 1982

• Uniprot-ID:
• P78344

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, 293T, Jurkat, LO2, Mouse brain