Rabbit anti-Human eIF4EBP1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-16323P

• Product Name:
• Rabbit anti-Human eIF4EBP1 Polyclonal Antibody

• Synonym:
• BP-1; 4EBP1; 4E-BP1; PHAS-I; P1

• Description:
• The antibody against eIF4EBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-118 of human eIF4EBP1. (NP_004086.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 50-118 of human eIF4EBP1. (NP_004086.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• eIF4EBP1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

• Gene ID:
• 1978

• Uniprot-ID:
• Q13541

• Purification Method:
• Affinity purification

• Positive Samples:
• K-562, HCT 116, HeLa