Rabbit anti-Human EIF4A2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04049P

• Product Name:
• Rabbit anti-Human EIF4A2 Polyclonal Antibody

• Synonym:
• DDX2B; EIF4A; EIF4F; BM-010; eIF4A-II; eIF-4A-II; EIF4A2

• Description:
• The antibody against EIF4A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human EIF4A2 (NP_001958.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human EIF4A2 (NP_001958.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• EIF4A2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYET

• Gene ID:
• 1974

• Uniprot-ID:
• Q14240

• Purification Method:
• Affinity purification

• Positive Samples:
• A-549, U-251MG, Raji, HepG2, HT-1080, Mouse liver, Mouse brain, Mouse spleen, Rat liver