Rabbit anti-Human eIF3e Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03783P

• Product Name:
• Rabbit anti-Human eIF3e Polyclonal Antibody

• Synonym:
• INT6; EIF3S6; EIF3-P48; eIF3-p46; eIF3e

• Description:
• The antibody against eIF3e was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-445 of human eIF3e (NP_001559.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-445 of human eIF3e (NP_001559.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• eIF3e

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY

• Gene ID:
• 3646

• Uniprot-ID:
• P60228

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7, K-562, HepG2, Raji