Rabbit anti-Human eIF3B Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01361P

• Product Name:
• Rabbit anti-Human eIF3B Polyclonal Antibody

• Synonym:
• PRT1; EIF3S9; EIF3-ETA; EIF3-P110; EIF3-P116; eIF3B

• Description:
• The antibody against eIF3B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-350 of human eIF3B (NP_003742.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 100-350 of human eIF3B (NP_003742.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• eIF3B

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PVPAQGEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLA

• Gene ID:
• 8662

• Uniprot-ID:
• P55884

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, Jurkat, HT-1080, LO2, NIH/3T3, Rat thymus