Rabbit anti-Human EEF1A2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11772P

• Product Name:
• Rabbit anti-Human EEF1A2 Polyclonal Antibody

• Synonym:
• HS1; STN; EF1A; STNL; DEE33; MRD38; EEF1AL; EIEE33; EF-1-alpha-2; EEF1A2

• Description:
• The antibody against EEF1A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 184-463 of human EEF1A2 (NP_001949.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 184-463 of human EEF1A2 (NP_001949.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• EEF1A2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILNHPGQISAGYSPVIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQKAGK

• Gene ID:
• 1917

• Uniprot-ID:
• Q05639

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7, Mouse heart, Rat skeletal muscle, Rat heart