Rabbit anti-Human DNAJC19 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05346P

• Product Name:
• Rabbit anti-Human DNAJC19 Polyclonal Antibody

• Synonym:
• PAM18; TIM14; TIMM14; DNAJC19

• Description:
• The antibody against DNAJC19 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human DNAJC19 (NP_660304.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human DNAJC19 (NP_660304.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• DNAJC19

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK

• Gene ID:
• 131118

• Uniprot-ID:
• Q96DA6

• Purification Method:
• Affinity purification

• Positive Samples:
• T-47D