Rabbit anti-Human DEFB4A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04554P

• Product Name:
• Rabbit anti-Human DEFB4A Polyclonal Antibody

• Synonym:
• BD-2; SAP1; DEFB2; DEFB4; HBD-2; DEFB-2; DEFB102; DEFB4A

• Description:
• The antibody against DEFB4A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-64 of human DEFB4A (NP_004933.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-64 of human DEFB4A (NP_004933.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• DEFB4A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

• Gene ID:
• 1673

• Uniprot-ID:
• O15263

• Purification Method:
• Affinity purification