Rabbit anti-Human DDX20 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03658P

• Product Name:
• Rabbit anti-Human DDX20 Polyclonal Antibody

• Synonym:
• DP103; GEMIN3; DDX20

• Description:
• The antibody against DDX20 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-280 of human DDX20 (NP_009135.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 25-280 of human DDX20 (NP_009135.4).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• DDX20

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VQVPAPEPTPGPVRILRTAQDLSSPRTRTGDVLLAEPADFESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPLSQDKTRLKKCHIAVGSPGRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMRDPTFVRLNSSDPSLIGLKQYY

• Gene ID:
• 11218

• Uniprot-ID:
• Q9UHI6

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7, ES-2, 293T, HepG2, HeLa, Mouse spleen, Rat testis, Mouse ovary