Rabbit anti-Human Cytokeratin 8 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-15511P

• Product Name:
• Rabbit anti-Human Cytokeratin 8 Polyclonal Antibody

• Synonym:
• K8; KO; CK8; CK-8; CYK8; K2C8; CARD2; 8

• Description:
• The antibody against Cytokeratin 8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 380-480 of human Cytokeratin 8 (NP_002264.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 380-480 of human Cytokeratin 8 (NP_002264.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Cytokeratin 8

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VKLALDIEIATYRKLLEGEESRLESGMQNMSIHTKTTSGYAGGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSFSRTSSSRAVVVKKIETRDGKLVSESSDV

• Gene ID:
• 3856

• Uniprot-ID:
• P05787

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, Mouse large intestine