Rabbit anti-Human CYP46A1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10882P

• Product Name:
• Rabbit anti-Human CYP46A1 Polyclonal Antibody

• Synonym:
• CP46; CYP46; CYP46A1

• Description:
• The antibody against CYP46A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-280 of human CYP46A1 (NP_006659.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 24-280 of human CYP46A1 (NP_006659.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CYP46A1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• HRARSRYEHIPGPPRPSFLLGHLPCFWKKDEVGGRVLQDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQIL

• Gene ID:
• 10858

• Uniprot-ID:
• Q9Y6A2

• Purification Method:
• Affinity purification

• Positive Samples:
• U-87MG, U-251MG, MCF7, Mouse liver, Mouse brain, Rat liver