Rabbit anti-Human CYP3A4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11468P

• Product Name:
• Rabbit anti-Human CYP3A4 Polyclonal Antibody

• Synonym:
• HLP; CP33; CP34; CYP3A; NF-25; VDDR3; CYP3A3; P450C3; CYPIIIA3; CYPIIIA4; P450PCN1; CYP3A4

• Description:
• The antibody against CYP3A4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 244-503 of human CYP3A4 (NP_059488.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 244-503 of human CYP3A4 (NP_059488.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CYP3A4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• EVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA

• Gene ID:
• 1576

• Uniprot-ID:
• P08684

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat liver