Rabbit anti-Human CYP27B1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09969P

• Product Name:
• Rabbit anti-Human CYP27B1 Polyclonal Antibody

• Synonym:
• VDR; CP2B; CYP1; PDDR; VDD1; VDDR; VDDRI; CYP27B; P450c1; CYP1alpha; CYP27B1

• Description:
• The antibody against CYP27B1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-195 of human CYP27B1 (NP_000776.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 25-195 of human CYP27B1 (NP_000776.1).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CYP27B1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LGYREYHSARRSLADIPGPSTPSFLAELFCKGGLSRLHELQVQGAAHFGPVWLASFGTVRTVYVAAPALVEELLRQEGPRPERCSFSPWTEHRRCRQRACGLLTAEGEEWQRLRSLLAPLLLRPQAAARYAGTLNNVVCDLVRRLRRQRGRGTGPPALVRDVAGEFYKFGL

• Gene ID:
• 1594

• Uniprot-ID:
• O15528

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat kidney, Rat liver