Rabbit anti-Human CYP11B1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00124P

• Product Name:
• Rabbit anti-Human CYP11B1 Polyclonal Antibody

• Synonym:
• FHI; CPN1; CYP11B; P450C11; CYP11B1

• Description:
• The antibody against CYP11B1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 234-503 of human CYP11B1 (NP_000488.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 234-503 of human CYP11B1 (NP_000488.3).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CYP11B1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN

• Gene ID:
• 1584

• Uniprot-ID:
• P15538

• Purification Method:
• Affinity purification