Rabbit anti-Human Cyclophilin 40 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11068P

• Product Name:
• Rabbit anti-Human Cyclophilin 40 Polyclonal Antibody

• Synonym:
• CYPD; CYP-40; Cyclophilin 40

• Description:
• The antibody against Cyclophilin 40 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 161-370 of human Cyclophilin 40 (NP_005029.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 161-370 of human Cyclophilin 40 (NP_005029.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Cyclophilin 40

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• ILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKNIGNTFFKSQNWEMAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIGACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAVYAKMFA

• Gene ID:
• 5481

• Uniprot-ID:
• Q08752

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2, NIH/3T3, MCF7, U-87MG, Mouse brain, Rat brain