Rabbit anti-Human CYB5R1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09603P

• Product Name:
• Rabbit anti-Human CYB5R1 Polyclonal Antibody

• Synonym:
• B5R1; B5R2; B5R.1; NQO3A2; humb5R2; CYB5R1

• Description:
• The antibody against CYB5R1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-305 of human CYB5R1 (NP_057327.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-305 of human CYB5R1 (NP_057327.2).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CYB5R1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY

• Gene ID:
• 51706

• Uniprot-ID:
• Q9UHQ9

• Purification Method:
• Affinity purification

• Positive Samples:
• A-431, HeLa