Rabbit anti-Human CXCR3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12276P

• Product Name:
• Rabbit anti-Human CXCR3 Polyclonal Antibody

• Synonym:
• GPR9; MigR; CD182; CD183; Mig-R; CKR-L2; CMKAR3; IP10-R; CXCR3

• Description:
• The antibody against CXCR3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 289-368 of human CXCR3 (NP_001495.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 289-368 of human CXCR3 (NP_001495.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CXCR3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NCGRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSSSRRDSSWSETSEASYSGL

• Gene ID:
• 2833

• Uniprot-ID:
• P49682

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, K-562, HepG2, SGC996, SW620