Rabbit anti-Human Cullin 4A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05947P

• Product Name:
• Rabbit anti-Human Cullin 4A Polyclonal Antibody

• Synonym:
• CUL4A; cullin-4A; Cullin 4A

• Description:
• The antibody against Cullin 4A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 510-759 of human Cullin 4A (NP_001008895.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 510-759 of human Cullin 4A (NP_001008895.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Cullin 4A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QHMQNQSDSGPIDLTVNILTMGYWPTYTPMEVHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA

• Gene ID:
• 8451

• Uniprot-ID:
• Q13619

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, NCI-H460, HepG2, HL-60, HT-1080, Mouse brain, Mouse liver