Rabbit anti-Human CSRP1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08595P

• Product Name:
• Rabbit anti-Human CSRP1 Polyclonal Antibody

• Synonym:
• CRP; CRP1; CSRP; CYRP; D1S181E; HEL-141; HEL-S-286; CSRP1

• Description:
• The antibody against CSRP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human CSRP1 (NP_004069.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, RIP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human CSRP1 (NP_004069.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IP, RIP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CSRP1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE

• Gene ID:
• 1465

• Uniprot-ID:
• P21291

• Purification Method:
• Affinity purification

• Positive Samples:
• A-549, BT-474, HeLa, Mouse lung, Mouse brain