Rabbit anti-Human CSMD2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10226P

• Product Name:
• Rabbit anti-Human CSMD2 Polyclonal Antibody

• Synonym:
• dJ947L8.1; dJ1007G16.1; dJ1007G16.2; CSMD2

• Description:
• The antibody against CSMD2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2050-2150 of human CSMD2 (NP_443128.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 2050-2150 of human CSMD2 (NP_443128.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CSMD2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TSHETTVYFHSDHSQNRPGFKLEYQDLTYSHQISSFLRGFDLSELERTNSTPPVAASYVWDLDPGCEAYELQECPDPEPFANGIVRGAGYNVGQSVTFECL

• Gene ID:
• 114784

• Uniprot-ID:
• Q7Z408

• Purification Method:
• Affinity purification

• Positive Samples:
• U-87MG, Mouse brain, Rat brain