Rabbit anti-Human CSF2RA Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03491P

• Product Name:
• Rabbit anti-Human CSF2RA Polyclonal Antibody

• Synonym:
• GMR; CD116; CSF2R; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; alphaGMR; GMR-alpha; GMCSFR-alpha; GM-CSF-R-alpha; CSF2RA

• Description:
• The antibody against CSF2RA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-150 of human CSF2RA (NP_001155001.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 23-150 of human CSF2RA (NP_001155001.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CSF2RA

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQY

• Gene ID:
• 1438

• Uniprot-ID:
• P15509

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse liver, Mouse brain, Rat brain, Rat liver