Rabbit anti-Human Creatine kinase B type (CKB) Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11474P

• Product Name:
• Rabbit anti-Human Creatine kinase B type (CKB) Polyclonal Antibody

• Synonym:
• BCK; B-CK; CKBB; CPK-B; HEL-211; HEL-S-29; Creatine kinase B type (CKB)

• Description:
• The antibody against Creatine kinase B type (CKB) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 182-381 of human Creatine kinase B type (Creatine kinase B type (CKB)) (NP_001814.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 182-381 of human Creatine kinase B type (Creatine kinase B type (CKB)) (NP_001814.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Creatine kinase B type (CKB)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK

• Gene ID:
• 1152

• Uniprot-ID:
• P12277

• Purification Method:
• Affinity purification

• Positive Samples:
• A-549, HT-29, HeLa, Mouse brain, Rat spinal cord