Rabbit anti-Human CRB1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06761P

• Product Name:
• Rabbit anti-Human CRB1 Polyclonal Antibody

• Synonym:
• LCA8; RP12; CRB1-A; CRB1-B; CRB1-C; CRB1

• Description:
• The antibody against CRB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-133 of human CRB1 (NP_957705.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 28-133 of human CRB1 (NP_957705.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CRB1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NKNNTRCLSNSCQNNSTCKDFSKDNDCSCSDTANNLDKDCDNMKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQHGGICHQDPIYPV

• Gene ID:
• 23418

• Uniprot-ID:
• P82279

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa