Rabbit anti-Human COX IV Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08042P

• Product Name:
• Rabbit anti-Human COX IV Polyclonal Antibody

• Synonym:
• COX4; COXIV; COX4-1; COXIV-1; MC4DN16; COX IV-1; [KD Validated] COX IV

• Description:
• The antibody against COX IV was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-98 of human COX IV. (NP_001852.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 23-98 of human COX IV. (NP_001852.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• COX IV

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSN

• Gene ID:
• 1327

• Uniprot-ID:
• P13073

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T(KD), HepG2, Mouse heart, Rat heart