Rabbit anti-Human COL9A3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00931P

• Product Name:
• Rabbit anti-Human COL9A3 Polyclonal Antibody

• Synonym:
• IDD; MED; EDM3; STL6; DJ885L7.4.1; COL9A3

• Description:
• The antibody against COL9A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 445-684 of human COL9A3 (NP_001844.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 445-684 of human COL9A3 (NP_001844.3).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• COL9A3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GSDGLPGDKGELGPSGLVGPKGESGSRGELGPKGTQGPNGTSGVQGVPGPPGPLGLQGVPGVPGITGKPGVPGKEASEQRIRELCGGMISEQIAQLAAHLRKPLAPGSIGRPGPAGPPGPPGPPGSIGHPGARGPPGYRGPTGELGDPGPRGNQGDRGDKGAAGAGLDGPEGDQGPQGPQGVPGTSKDGQDGAPGEPGPPGDPGLPGAIGAQGTPGICDTSACQGAVLGGVGEKSGSRSS

• Gene ID:
• 1299

• Uniprot-ID:
• Q14050

• Purification Method:
• Affinity purification