Rabbit anti-Human COL10A1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10661P

• Product Name:
• Rabbit anti-Human COL10A1 Polyclonal Antibody

• Synonym:
• COL10A1; collagen alpha-1(X) chain

• Description:
• The antibody against COL10A1 was raised in Rabbit using the recombinant protein of human COL10A1 as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant protein of human COL10A1.

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• COL10A1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFSYHVHVKGTHVWVGLYKNGTPVMYTYDEYTKGYLDQASGSAIIDLTENDQVWLQLPNAESNGLYSSEYVHSSFSGFLVAPM

• Gene ID:
• 1300

• Uniprot-ID:
• Q03692

• Purification Method:
• Affinity purification

• Positive Samples:
• HT-1080