Rabbit anti-Human CNPase Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11715P

• Product Name:
• Rabbit anti-Human CNPase Polyclonal Antibody

• Synonym:
• CNP1; HLD20; CNPase

• Description:
• The antibody against CNPase was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-421 of human CNPasease (NP_149124.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 150-421 of human CNPasease (NP_149124.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CNPase

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PKTAWRLDCAQLKEKNQWQLSADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRQFVPGDEPREKMDLVTYFGKRPPGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARVELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITLGCAADVEAVQTGLDLLEILRQEKGGSRGEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII

• Gene ID:
• 1267

• Uniprot-ID:
• P09543

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2, 293T, Rat brain, Mouse brain, Hep G2, A-375