Rabbit anti-Human CMTM3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04231P

• Product Name:
• Rabbit anti-Human CMTM3 Polyclonal Antibody

• Synonym:
• BNAS2; CKLFSF3; CMTM3

• Description:
• The antibody against CMTM3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-182 of human CMTM3 (NP_653202.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 100-182 of human CMTM3 (NP_653202.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CMTM3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MMDFLRCVTAALIYFAISITAIAKYSDGASKAAGVFGFFATIVFATDFYLIFNDVAKFLKQGDSADETTAHKTEEENSDSDSD

• Gene ID:
• 123920

• Uniprot-ID:
• Q96MX0

• Purification Method:
• Affinity purification

• Positive Samples:
• 231