Rabbit anti-Human CMAS Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06062P

• Product Name:
• Rabbit anti-Human CMAS Polyclonal Antibody

• Synonym:
• CSS; CMAS

• Description:
• The antibody against CMAS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-263 of human CMAS (NP_061156.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-263 of human CMAS (NP_061156.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CMAS

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MDSVEKGAATSVSNPRGRPSRGRPPKLQRNSRGGQGRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAFQSVWVSTDHDEIENVAKQFGAQVHRRSSEVSKDSSTSLDAIIEFLNYHNEVDIVGNIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAEQRVLR

• Gene ID:
• 55907

• Uniprot-ID:
• Q8NFW8

• Purification Method:
• Affinity purification

• Positive Samples:
• U-87MG, HT-29, 293T, HepG2, DU145, Mouse heart, Rat liver