Rabbit anti-Human CLN8 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03907P

• Product Name:
• Rabbit anti-Human CLN8 Polyclonal Antibody

• Synonym:
• EPMR; TLCD6; C8orf61; CLN8

• Description:
• The antibody against CLN8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-286 of human CLN8 (NP_061764.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 200-286 of human CLN8 (NP_061764.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CLN8

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MFHCRMVLTYHMWWVCFWHWDGLVSSLYLPHLTLFLVGLALLTLIINPYWTHKKTQQLLNPVDWNFAQPEAKSRPEGNGQLLRKKRP

• Gene ID:
• 2055

• Uniprot-ID:
• Q9UBY8

• Purification Method:
• Affinity purification

• Positive Samples:
• SKOV3, LO2, HeLa, K-562