Rabbit anti-Human Cleaved Notch1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08026P

• Product Name:
• Rabbit anti-Human Cleaved Notch1 Polyclonal Antibody

• Synonym:
• AOS5; AOVD1; TAN1; hN1; NOTCH1; Activated NOTCH1; notch 1; Cleaved Notch1

• Description:
• The antibody against Cleaved Notch1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2381-2480 of human Cleaved Notch1. (NP_060087.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 2381-2480 of human Cleaved Notch1. (NP_060087.3).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Cleaved Notch1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QTQQVQPQNLQMQQQNLQPANIQQQQSLQPPPPPPQPHLGVSSAASGHLGRSFLSGEPSQADVQPLGPSSLAVHTILPQESPALPTSLPSSLVPPVTAAQ

• Gene ID:
• 4851

• Uniprot-ID:
• P46531

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T