Rabbit anti-Human Cleaved Gasdermin D（Gly276 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08281P

• Product Name:
• Rabbit anti-Human Cleaved Gasdermin D（Gly276 Polyclonal Antibody

• Synonym:
• DF5L; M2-4; Dfna5l; GsdmD-1; Gsdmdc1; 1810036L03Rik

• Description:
• The antibody against Cleaved Gasdermin D（Gly276 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human Cleaved GSDMD (NP_081236.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Cleaved GSDMD (NP_081236.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Cleaved Gasdermin D（Gly276

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTSEGAWPQLPSGLSMMRCLHNFLTDGVPAEGAFTEDFQGLRAEVETISKE

• Gene ID:
• 79792

• Uniprot-ID:
• P57764

• Purification Method:
• Affinity purification

• Positive Samples:
• Recombinant GSDMD Protein, THP-1 treated by LPS+Nigericin