Rabbit anti-Human CHD9 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02201P

• Product Name:
• Rabbit anti-Human CHD9 Polyclonal Antibody

• Synonym:
• AD013; CHD-9; CReMM; KISH2; PRIC320; CHD9

• Description:
• The antibody against CHD9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 85-190 of human CHD9 (NP_079410.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 85-190 of human CHD9 (NP_079410.4).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CHD9

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SFGSPAEHVLSPHSQFNCSPIHPQNQPNGLFPDVSDGSPMWGHQTATTISNQNGSPFHQQGHSHSMHQNKSFVAHHDFALFQANEQQTQCTSLRSQQNRNNLNPGQ

• Gene ID:
• 80205

• Uniprot-ID:
• Q3L8U1

• Purification Method:
• Affinity purification

• Positive Samples:
• U-87MG, HeLa, Jurkat, A-549, 293T, K-562, Mouse kidney