Rabbit anti-Human CFHR1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04280P

• Product Name:
• Rabbit anti-Human CFHR1 Polyclonal Antibody

• Synonym:
• H36; CFHL; FHR1; HFL1; HFL2; CFHL1; FHL-1; FHR-1; H36-1; H36-2; CFHL1P; CFHR1P; CFHR1

• Description:
• The antibody against CFHR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 151-330 of human CFHR1 (NP_002104.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 151-330 of human CFHR1 (NP_002104.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CFHR1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PTVQNAHILSRQMSKYPSGERVRYECRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYLRTGESAEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR

• Gene ID:
• 3078

• Uniprot-ID:
• Q03591

• Purification Method:
• Affinity purification

• Positive Samples:
• LO2, HeLa, NCI-H460, Mouse liver, Mouse lung, Mouse heart, Rat liver