Rabbit anti-Human CDKN2B Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11186P

• Product Name:
• Rabbit anti-Human CDKN2B Polyclonal Antibody

• Synonym:
• P15; MTS2; TP15; CDK4I; INK4B; p15INK4b; CDKN2B

• Description:
• The antibody against CDKN2B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-138 of human CDKN2B (NP_004927.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-138 of human CDKN2B (NP_004927.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CDKN2B

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD

• Gene ID:
• 1030

• Uniprot-ID:
• P42772

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, THP-1(negative), Mouse small intestine, Rat lung