Rabbit anti-Human CDK1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11271P

• Product Name:
• Rabbit anti-Human CDK1 Polyclonal Antibody

• Synonym:
• CDC2; CDC28A; P34CDC2; CDK1

• Description:
• The antibody against CDK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 198-297 of human CDK1 (NP_001777.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 198-297 of human CDK1 (NP_001777.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CDK1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• ATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM

• Gene ID:
• 983

• Uniprot-ID:
• P06493

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7, Jurkat, C6, Mouse kidney