Rabbit anti-Human CDK11B Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03268P

• Product Name:
• Rabbit anti-Human CDK11B Polyclonal Antibody

• Synonym:
• p58; PK58; CDK11; CLK-1; CDC2L1; PITSLREA; p58CLK-1; CDK11-p46; CDK11-p58; p58CDC2L1; CDK11-p110; CDK11B

• Description:
• The antibody against CDK11B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human CDK11B (NP_277021.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human CDK11B (NP_277021.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CDK11B

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKERE

• Gene ID:
• 984

• Uniprot-ID:
• P21127

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, Mouse brain