Rabbit anti-Human CDC5L Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11194P

• Product Name:
• Rabbit anti-Human CDC5L Polyclonal Antibody

• Synonym:
• CDC5; CEF1; PCDC5RP; CDC5-LIKE; dJ319D22.1; CDC5L

• Description:
• The antibody against CDC5L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 563-802 of human CDC5L (NP_001244.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 563-802 of human CDC5L (NP_001244.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CDC5L

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSEAYNQVWEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSKF

• Gene ID:
• 988

• Uniprot-ID:
• Q99459

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7, THP-1, K-562, SW480, Mouse spleen, Mouse thymus, Mouse testis