Rabbit anti-Human CDC25C Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01791P

• Product Name:
• Rabbit anti-Human CDC25C Polyclonal Antibody

• Synonym:
• CDC25; PPP1R60; CDC25C

• Description:
• The antibody against CDC25C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 174-473 of human CDC25C (NP_001781.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 174-473 of human CDC25C (NP_001781.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CDC25C

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP

• Gene ID:
• 995

• Uniprot-ID:
• P30307

• Purification Method:
• Affinity purification