Rabbit anti-Human CD80 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12579P

• Product Name:
• Rabbit anti-Human CD80 Polyclonal Antibody

• Synonym:
• B7; BB1; B7-1; B7.1; LAB7; CD28LG; CD28LG1; CD80

• Description:
• The antibody against CD80 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD80 (NP_005182.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD80 (NP_005182.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CD80

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLS

• Gene ID:
• 941

• Uniprot-ID:
• P33681

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat lung