Rabbit anti-Human CD73/NT5E Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04106P

• Product Name:
• Rabbit anti-Human CD73/NT5E Polyclonal Antibody

• Synonym:
• NT; eN; NT5; NTE; eNT; CD73; E5NT; CALJA; CD73/NT5E

• Description:
• The antibody against CD73/NT5E was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 32-264 of human CD73/NT5E (NP_002517.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 32-264 of human CD73/NT5E (NP_002517.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CD73/NT5E

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNPPSKEVPAGKYP

• Gene ID:
• 4907

• Uniprot-ID:
• P21589

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse lung, Rat liver