Rabbit anti-Human CD70 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01417P

• Product Name:
• Rabbit anti-Human CD70 Polyclonal Antibody

• Synonym:
• CD27L; LPFS3; CD27-L; CD27LG; TNFSF7; TNLG8A; CD70

• Description:
• The antibody against CD70 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-193 of human CD70 (NP_001243.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 100-193 of human CD70 (NP_001243.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CD70

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• RDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

• Gene ID:
• 970

• Uniprot-ID:
• P32970

• Purification Method:
• Affinity purification