Rabbit anti-Human CD66b/CEACAM8 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10453P

• Product Name:
• Rabbit anti-Human CD66b/CEACAM8 Polyclonal Antibody

• Synonym:
• CD67; CGM6; CD66b; NCA-95; CD66b/CEACAM8

• Description:
• The antibody against CD66b/CEACAM8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-320 of human CD66b/CEACAM8 (NP_001807.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 35-320 of human CD66b/CEACAM8 (NP_001807.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CD66b/CEACAM8

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD

• Gene ID:
• 1088

• Uniprot-ID:
• P31997

• Purification Method:
• Affinity purification