Rabbit anti-Human CD42b Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04667P

• Product Name:
• Rabbit anti-Human CD42b Polyclonal Antibody

• Synonym:
• BSS; GP1B; VWDP; CD42B; GPIbA; BDPLT1; BDPLT3; DBPLT3; GPIbalpha; CD42b-alpha; CD42b

• Description:
• The antibody against CD42b was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-259 of human CD42b (NP_000164.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on .

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 19-259 of human CD42b (NP_000164.5).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CD42b

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• ICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNV

• Gene ID:
• 2811

• Uniprot-ID:
• P07359

• Purification Method:
• Affinity purification