• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Polyclonal Antibody >

Rabbit anti-Human CD42b Polyclonal Antibody Online Inquiry

  • Cat#:
  • ADA-04667P
  • Product Name:
  • Rabbit anti-Human CD42b Polyclonal Antibody
  • Synonym:
  • BSS; GP1B; VWDP; CD42B; GPIbA; BDPLT1; BDPLT3; DBPLT3; GPIbalpha; CD42b-alpha; CD42b
  • Description:
  • The antibody against CD42b was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-259 of human CD42b (NP_000164.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on .
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant fusion protein containing a sequence corresponding to amino acids 19-259 of human CD42b (NP_000164.5).
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Storage Buffer:
  • PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Target Name:
  • CD42b
  • Form:
  • Liquid
  • Immunogen Species:
  • Human
  • Immunogen Sequence:
  • ICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNV
  • Gene ID:
  • 2811
  • Purification Method:
  • Affinity purification
  • Pre product:Rabbit anti-Human LHX1 Polyclonal Antibody-ADA-04666P
  • Online Inquiry

    refresh