Rabbit anti-Human CD40 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12486P

• Product Name:
• Rabbit anti-Human CD40 Polyclonal Antibody

• Synonym:
• p50; Bp50; CDW40; TNFRSF5; CD40

• Description:
• The antibody against CD40 was raised in Rabbit using the recombinant fusion protein containing a sequence within amino acids 198-277 of human CD40 (NP_001241.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence within amino acids 198-277 of human CD40 (NP_001241.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CD40

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• IPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ

• Gene ID:
• 958

• Uniprot-ID:
• P25942

• Purification Method:
• Affinity purification

• Positive Samples:
• Raji