Rabbit anti-Human CD320 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01146P

• Product Name:
• Rabbit anti-Human CD320 Polyclonal Antibody

• Synonym:
• 8D6; 8D6A; TCBLR; TCN2R; TCII-R; sCD320; CD320

• Description:
• The antibody against CD320 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 36-229 of human CD320 (NP_057663.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 36-229 of human CD320 (NP_057663.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CD320

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAY

• Gene ID:
• 51293

• Uniprot-ID:
• Q9NPF0

• Purification Method:
• Affinity purification

• Positive Samples:
• U-251MG