Rabbit anti-Human CD276 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08293P

• Product Name:
• Rabbit anti-Human CD276 Polyclonal Antibody

• Synonym:
• B7H3; B7-H3; B7RP-2; 4Ig-B7-H3; CD276

• Description:
• The antibody against CD276 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 29-245 of human CD276(NP_079516.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 29-245 of human CD276(NP_079516.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CD276

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP

• Gene ID:
• 80381

• Uniprot-ID:
• Q5ZPR3-2

• Purification Method:
• Affinity purification

• Positive Samples:
• U-2 OS, LNCaP