Rabbit anti-Human CD215/IL-15R alpha Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04217P

• Product Name:
• Rabbit anti-Human CD215/IL-15R alpha Polyclonal Antibody

• Synonym:
• CD215; CD215/IL-15R alpha

• Description:
• The antibody against CD215/IL-15R alpha was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 167-267 of human CD215/IL-15R alpha (NP_002180.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 167-267 of human CD215/IL-15R alpha (NP_002180.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CD215/IL-15R alpha

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLACYLKSRQTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL

• Gene ID:
• 3601

• Uniprot-ID:
• Q13261

• Purification Method:
• Affinity purification

• Positive Samples:
• THP-1