Rabbit anti-Human CD151 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04458P

• Product Name:
• Rabbit anti-Human CD151 Polyclonal Antibody

• Synonym:
• EBS7; GP27; MER2; RAPH; SFA1; PETA-3; TSPAN24; CD151

• Description:
• The antibody against CD151 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 113-221 of human CD151 (NP_004348.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 113-221 of human CD151 (NP_004348.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CD151

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR

• Gene ID:
• 977

• Uniprot-ID:
• P48509

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat uterus